PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0051s0520.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 340aa    MW: 37912.3 Da    PI: 9.0567
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0051s0520.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.55e-2379123145
                     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                             d+epgrCrRtDGKkWRCs+++ +++k+CErH++r+r+rsrk++e+
  SapurV1A.0051s0520.1.p  79 DSEPGRCRRTDGKKWRCSKDAHPDSKYCERHMNRSRNRSRKPVES 123
                             689***************************************986 PP

2QLQ57.34.8e-201853237
                     QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                             FTaaQ+++L++Q+l++KyL a++PvPp+Ll +i+k
  SapurV1A.0051s0520.1.p 18 VFTAAQWHELEHQALIFKYLKAGLPVPPYLLHPIRK 53
                            5*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.1E-111753IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.1741853IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.3E-161952IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.4579123IPR014977WRC domain
PfamPF088791.1E-1981122IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MSNSSVTVAA VGPRAQPVFT AAQWHELEHQ ALIFKYLKAG LPVPPYLLHP IRKSFQLPPP  60
GYLHPSNLSY CSYFGKKIDS EPGRCRRTDG KKWRCSKDAH PDSKYCERHM NRSRNRSRKP  120
VESQTASQSV STVASEIVTG SSSRAYTTMP LPTIDNSVAI GFGSNMSRWQ MESMPYGANS  180
KDYRSLHGLK LVADEKNFLS EALGNTRSFG MNSNVDSTWH LASEVQANPV PESRNDALLQ  240
NYPQLQTLQD FEPLTVDDAA SKQQQQQYLF GREFSSSGST RQENQSLQPL FDEWPKCRDM  300
DSYFTAQRSN KSSSGVQLSM AIPMAPNSAA RNYHSPNDA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006368308.10.0hypothetical protein POPTR_0001s01480g
TrEMBLU5GUE90.0U5GUE9_POPTR; Uncharacterized protein
STRINGPOPTR_0001s01480.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47812951
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.19e-41growth-regulating factor 2